PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR02G21120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family DBB
Protein Properties Length: 266aa    MW: 28061.2 Da    PI: 5.1166
Description DBB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR02G21120.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.42.2e-06443538
         zf-B_box  5 kCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                      C+ +  + ++ fC  ++  lC+ C    H+       H+
  LPERR02G21120.1  4 QCDVCAAEAASVFCCADEAALCDACDRRVHQAnklagkHR 43
                     7***************************997666777776 PP

2zf-B_box26.71.2e-086295336
         zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg 36
                     ++ C+ ++ek+  lfC++++  lC++C ++ H  
  LPERR02G21120.1 62 APLCDICQEKRGFLFCKEDRAILCRECDVSVHTT 95
                     689***************************9954 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.4E-11147IPR000315B-box-type zinc finger
PROSITE profilePS501199.84147IPR000315B-box-type zinc finger
CDDcd000213.56E-6347No hitNo description
PfamPF006432.8E-5444IPR000315B-box-type zinc finger
SMARTSM003365.8E-1260107IPR000315B-box-type zinc finger
PROSITE profilePS5011910.05460107IPR000315B-box-type zinc finger
PfamPF006435.3E-762102IPR000315B-box-type zinc finger
CDDcd000212.29E-863107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009641Biological Processshade avoidance
GO:0005622Cellular Componentintracellular
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MKVQCDVCAA EAASVFCCAD EAALCDACDR RVHQANKLAG KHRRFSLLNP SSASSGRSSS  60
AAPLCDICQE KRGFLFCKED RAILCRECDV SVHTTSELTM RHSRFLLTGV RLSSEPAATP  120
AQSSEEESCS GGDDAVPAPA LATSQGGSSG SGSSISEYLT KTLPGWHVED FLVDDATAET  180
VAAAAATASS SISAVNGPCQ GTTRIGGLQE SAAYPMWMAQ QQLCCDSLVA GDAVASRERW  240
VPQMYTDQLA AGSKRSRTST SSYSYW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0715070.0AK071507.1 Oryza sativa Japonica Group cDNA clone:J023090D24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623928.11e-132PREDICTED: B-box zinc finger protein 20
SwissprotQ9LQZ72e-57BBX21_ARATH; B-box zinc finger protein 21
TrEMBLA0A0D9VIV80.0A0A0D9VIV8_9ORYZ; Uncharacterized protein
STRINGLOC_Os02g43170.11e-132(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23923679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75540.14e-39salt tolerance homolog2